PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.9G031000.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family GRAS
Protein Properties Length: 645aa    MW: 73069.5 Da    PI: 6.641
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.9G031000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS371.79.5e-1142736432374
                GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilk 92 
                         ++lL++cA+a + +d+++a++lL+++++++s +gd+ qRla+yf+++L+arla+++s++y++l++++ts   + e l a+ l+++++ +  
  Sevir.9G031000.1.p 273 TTLLIHCAQAAAIDDHRNANELLKQIRKHSSATGDAGQRLAHYFANGLEARLAGTGSSIYRSLTSKRTS---TGEMLRAFGLYVKACSFRL 360
                         689************************************************************999998...899**************** PP

                GRAS  93 fshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvl 181
                         +sh +aN +Il+a ++e r+HiiD+++++G+QWp L+q L++R +gppslRiTg++ p +g   +e++e+tg+rL+++A+ +++pfe+++ 
  Sevir.9G031000.1.p 361 ISHYVANTTILNASKSEARLHIIDYGVQYGFQWPVLMQRLSKRCGGPPSLRITGIDFPLPGfrPAERIEATGRRLHEYARMFNIPFEYQA- 450
                         **********************************************************99999***************************. PP

                GRAS 182 vakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsle 272
                         +a++++++++e+L++k++E l+Vn+ +++ +++de+v+ +s+r++vL+++++l+P+++v+   +  +n++ F++rf ea+ ++s++fd+le
  Sevir.9G031000.1.p 451 IASKWDTIQVEDLKIKSDEYLVVNCLYRMRNMMDETVTDDSPRTRVLNTIRKLNPHLFVHGIVNGTYNAPFFVTRFKEAMFFFSSIFDMLE 541
                         7****************************************************************************************** PP

                GRAS 273 aklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWk 363
                         a+++r +e+r  +E e++gre+ nv+aceg+er+er et+++W++r  +aGF++++l+e+++k a++ ++k + + + v+e+++++++gWk
  Sevir.9G031000.1.p 542 ANASRMDEHRLLIESEFFGREALNVIACEGTERIERPETYKQWQMRNLRAGFRQLRLNEEIMKRARYKVSKSYHRDFLVDEDNKWMLQGWK 632
                         *************************************************************************999*************** PP

                GRAS 364 drpLvsvSaWr 374
                         +r ++++SaW+
  Sevir.9G031000.1.p 633 GRIIFALSAWT 643
                         **********6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098566.146246623IPR005202Transcription factor GRAS
PfamPF035143.3E-111273643IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 645 aa     Download sequence    Send to blast
MMDPGSRDNI DFGDQLSTPN PPTPHMINFS LQQQSQVQYF PSYGFHSHNP PVSSHPSPPW  60
VMLGCTTPSP ASTTTTELDS ADDADDAVLA YINQFLLEDE DDESYPVSSA SVEDSALLAV  120
EKPFVDILKS AKPIMAQAYE MKSWMTDDCE STGSRGFHDV VTSNQNSSQL PSQMVVECSV  180
GATHKGRKTK NPHDDDLEME ERKSKQLALC DEETVREMFD KVLLCTDANC EFHSPMPAEA  240
QINGRYVKGS GNRRGRRKGR SGTSPEEEAV DLTTLLIHCA QAAAIDDHRN ANELLKQIRK  300
HSSATGDAGQ RLAHYFANGL EARLAGTGSS IYRSLTSKRT STGEMLRAFG LYVKACSFRL  360
ISHYVANTTI LNASKSEARL HIIDYGVQYG FQWPVLMQRL SKRCGGPPSL RITGIDFPLP  420
GFRPAERIEA TGRRLHEYAR MFNIPFEYQA IASKWDTIQV EDLKIKSDEY LVVNCLYRMR  480
NMMDETVTDD SPRTRVLNTI RKLNPHLFVH GIVNGTYNAP FFVTRFKEAM FFFSSIFDML  540
EANASRMDEH RLLIESEFFG REALNVIACE GTERIERPET YKQWQMRNLR AGFRQLRLNE  600
EIMKRARYKV SKSYHRDFLV DEDNKWMLQG WKGRIIFALS AWTS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-462766428374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004981240.10.0PREDICTED: scarecrow-like protein 30
SwissprotQ9XE581e-170SCL14_ARATH; Scarecrow-like protein 14
TrEMBLK4A6X20.0K4A6X2_SETIT; Uncharacterized protein
STRINGSi034627m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP138412529
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.11e-169SCARECROW-like 14